SPATA16 antibody (N-Term)

Catalog No. ABIN632429

The Rabbit Polyclonal anti-SPATA16 antibody has been validated for WB. It is suitable to detect SPATA16 in samples from Human.

Quick Overview for SPATA16 antibody (N-Term) (ABIN632429)

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SPATA16 Antibody

Binding Specificity: N-Term

Specificity: SPATA16 antibody was raised against the N terminal of SPATA16

Purification: Affinity purified

Immunogen: SPATA16 antibody was raised using the N terminal of SPATA16 corresponding to a region with amino acids MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA16 Blocking Peptide, (ABIN5616358), is also available for use as a blocking control in assays to test for specificity of this SPATA16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA16

Target: SPATA16 (Spermatogenesis Associated 16 (SPATA16))

Alternative Name: SPATA16

Background: SPATA16 is involved in the formation of sperm acrosome, which implicated its potential role in spermatogenesis and sperm-egg fusion. Defects in SPATA16 are a cause of globozoospermia, also called Round-headed spermatozoa.

Molecular Weight: 63 kDa (MW of target protein)