LRP2BP antibody (Middle Region)

Catalog No. ABIN632431

This Rabbit Polyclonal antibody specifically detects LRP2BP in WB. It exhibits reactivity toward Human, Rat, Dog and Mouse.

Quick Overview for LRP2BP antibody (Middle Region) (ABIN632431)

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Reactivity: Human, Rat, Dog, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRP2BP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRP2BP Antibody

Binding Specificity: Middle Region

Specificity: LRP2 BP antibody was raised against the middle region of LRP2 P

Purification: Affinity purified

Immunogen: LRP2 BP antibody was raised using the middle region of LRP2 P corresponding to a region with amino acids RSNEEAERLWLIAADNGNPKASVKAQSMLGLYYSTKEPKELEKAFYWHSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRP2BP Blocking Peptide, (ABIN5614567), is also available for use as a blocking control in assays to test for specificity of this LRP2BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRP2BP

Target: LRP2BP (LRP2 Binding Protein (LRP2BP))

Alternative Name: LRP2BP

Background: LRP2BP may act as an adapter that regulates LRP2 function.

Molecular Weight: 38 kDa (MW of target protein)