GSPT2 antibody (Middle Region)

Catalog No. ABIN632432

The Rabbit Polyclonal anti-GSPT2 antibody has been validated for WB. It is suitable to detect GSPT2 in samples from Human.

Quick Overview for GSPT2 antibody (Middle Region) (ABIN632432)

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GSPT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GSPT2 Antibody

Binding Specificity: Middle Region

Specificity: GSPT2 antibody was raised against the middle region of GSPT2

Purification: Affinity purified

Immunogen: GSPT2 antibody was raised using the middle region of GSPT2 corresponding to a region with amino acids GANIKEQSDFCPWYTGLPFIPYLDNLPNFNRSIDGPIRLPIVDKYKDMGT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GSPT2 Blocking Peptide, (ABIN938549), is also available for use as a blocking control in assays to test for specificity of this GSPT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSPT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GSPT2

Target: GSPT2 (G1 To S Phase Transition 2 (GSPT2))

Alternative Name: GSPT2

Background: GSPT2 is closely related to GSPT1, a GTP-binding protein that plays an essential role at the G1- to S-phase transition of the cell cycle in yeast and human cells. GSPT1 is a positive regulator of translational accuracy and, in a binary complex with eRF1, functions as a polypeptide chain release factor.

Molecular Weight: 69 kDa (MW of target protein)