Exophilin 5 antibody (Middle Region)

Catalog No. ABIN632437

This Rabbit Polyclonal antibody specifically detects Exophilin 5 in WB. It exhibits reactivity toward Human.

Quick Overview for Exophilin 5 antibody (Middle Region) (ABIN632437)

Target: Exophilin 5 (EXPH5)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Exophilin 5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Exophilin 5 Antibody

Binding Specificity: Middle Region

Specificity: EXPH5 antibody was raised against the middle region of EXPH5

Purification: Affinity purified

Immunogen: EXPH5 antibody was raised using the middle region of EXPH5 corresponding to a region with amino acids QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVPEDGLSPSEPL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXPH5 Blocking Peptide, (ABIN5613438), is also available for use as a blocking control in assays to test for specificity of this EXPH5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXPH5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Exophilin 5

Target: Exophilin 5 (EXPH5)

Alternative Name: EXPH5

Background: EXPH5 may act as a Rab effector protein and play a role in vesicle trafficking.

Molecular Weight: 222 kDa (MW of target protein)