BEND7 antibody (N-Term)

Catalog No. ABIN632443

This Rabbit Polyclonal antibody specifically detects BEND7 in WB. It exhibits reactivity toward Human.

Quick Overview for BEND7 antibody (N-Term) (ABIN632443)

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BEND7 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-BEND7 Antibody

Binding Specificity: N-Term

Specificity: C10 orf30 antibody was raised against the N terminal of C10 rf30

Purification: Affinity purified

Immunogen: C10 orf30 antibody was raised using the N terminal of C10 rf30 corresponding to a region with amino acids AGSNCCTCNCQSTLQAILQELKTMRKLMQIQAVGTQNRQQPPISLICSQR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C10orf30 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this C10orf30 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf30 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BEND7

Target: BEND7 (BEN Domain Containing 7 (BEND7))

Alternative Name: C10orf30

Background: The function of Chromosome 10 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 51 kDa (MW of target protein)