CMTR2 antibody (Middle Region)

Catalog No. ABIN632447

The Rabbit Polyclonal anti-CMTR2 antibody has been validated for WB. It is suitable to detect CMTR2 in samples from Human.

Quick Overview for CMTR2 antibody (Middle Region) (ABIN632447)

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMTR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CMTR2 Antibody

Binding Specificity: Middle Region

Specificity: FTSJD1 antibody was raised against the middle region of FTSJD1

Purification: Affinity purified

Immunogen: FTSJD1 antibody was raised using the middle region of FTSJD1 corresponding to a region with amino acids LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FTSJD1 Blocking Peptide, (ABIN5613653), is also available for use as a blocking control in assays to test for specificity of this FTSJD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTSJD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMTR2

Target: CMTR2 (Cap Methyltransferase 2 (CMTR2))

Alternative Name: FTSJD1

Background: The function of FTSJ protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 88 kDa (MW of target protein)