FAM83E antibody (Middle Region)

Catalog No. ABIN632448

The Rabbit Polyclonal anti-FAM83E antibody (ABIN632448) specifically detects FAM83E in WB. The antibody is reactive with Human samples.

Quick Overview for FAM83E antibody (Middle Region) (ABIN632448)

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM83E antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM83E Antibody

Binding Specificity: Middle Region

Specificity: FAM83 E antibody was raised against the middle region of FAM83

Purification: Affinity purified

Immunogen: FAM83 E antibody was raised using the middle region of FAM83 corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM83E Blocking Peptide, (ABIN5613510), is also available for use as a blocking control in assays to test for specificity of this FAM83E antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM80 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM83E

Target: FAM83E (Family with Sequence Similarity 83, Member E (FAM83E))

Alternative Name: FAM83E

Background: The function of FAM83 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 52 kDa (MW of target protein)