GBX1 antibody (Middle Region)

Catalog No. ABIN632458

This Rabbit Polyclonal antibody specifically detects GBX1 in WB. It exhibits reactivity toward Mouse, Rat, Human and Drosophila melanogaster.

Quick Overview for GBX1 antibody (Middle Region) (ABIN632458)

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Reactivity: Mouse, Rat, Human, Drosophila melanogaster

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GBX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GBX1 Antibody

Binding Specificity: Middle Region

Specificity: GBX1 antibody was raised against the middle region of Gbx-1

Purification: Affinity purified

Immunogen: GBX1 antibody was raised using the middle region of Gbx-1 corresponding to a region with amino acids AKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQGARP

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GBX1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this GBX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GBX-1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GBX1

Target: GBX1 (Gastrulation Brain Homeobox 1 (GBX1))

Alternative Name: GBX1

Background: GBX-1 contains 1 homeobox DNA-binding domain. The exact functions of GBX-1 remain unknown.

Molecular Weight: 40 kDa (MW of target protein)