MAGEB3 antibody (N-Term)

Catalog No. ABIN632466

This anti-MAGEB3 antibody is a Rabbit Polyclonal antibody detecting MAGEB3 in WB. Suitable for Human.

Quick Overview for MAGEB3 antibody (N-Term) (ABIN632466)

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEB3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEB3 Antibody

Binding Specificity: N-Term

Specificity: MAGEB3 antibody was raised against the N terminal of MAGEB3

Purification: Affinity purified

Immunogen: MAGEB3 antibody was raised using the N terminal of MAGEB3 corresponding to a region with amino acids MPRGQKSTLHAREKRQQTRGQTQDHQGAQITATNKKKVSFSSPLILGATI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEB3 Blocking Peptide, (ABIN5614636), is also available for use as a blocking control in assays to test for specificity of this MAGEB3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEB3

Target: MAGEB3 (Melanoma Antigen Family B, 3 (MAGEB3))

Alternative Name: MAGEB3

Background: This gene is a MAGE-B subfamily member of the MAGE gene family. MAGE family member proteins direct the expression of tumor antigens recognised on a human melanoma by autologous cytolytic T lymphocytes. There are two known clusters of MAGE genes on chromos

Molecular Weight: 39 kDa (MW of target protein)