TRAPPC2L antibody (N-Term)

Catalog No. ABIN632473

This Rabbit Polyclonal antibody specifically detects TRAPPC2L in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TRAPPC2L antibody (N-Term) (ABIN632473)

Target: TRAPPC2L

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRAPPC2L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TRAPPC2L Antibody

Binding Specificity: N-Term

Specificity: TRAPPC2 L antibody was raised against the N terminal of TRAPPC2

Purification: Affinity purified

Immunogen: TRAPPC2 L antibody was raised using the N terminal of TRAPPC2 corresponding to a region with amino acids MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRAPPC2L Blocking Peptide, (ABIN5616767), is also available for use as a blocking control in assays to test for specificity of this TRAPPC2L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAPPC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRAPPC2L

Target: TRAPPC2L

Background: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Molecular Weight: 16 kDa (MW of target protein)