TMCO6 antibody (N-Term)

Catalog No. ABIN632475

This anti-TMCO6 antibody is a Rabbit Polyclonal antibody detecting TMCO6 in WB. Suitable for Human.

Quick Overview for TMCO6 antibody (N-Term) (ABIN632475)

Target: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMCO6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMCO6 Antibody

Binding Specificity: N-Term

Specificity: TMCO6 antibody was raised against the N terminal of TMCO6

Purification: Affinity purified

Immunogen: TMCO6 antibody was raised using the N terminal of TMCO6 corresponding to a region with amino acids LRQAQRGTEEKEREGALVSLRRGLQHPETQQTFIRLEGSMRTLVGLLTSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMCO6 Blocking Peptide, (ABIN5616651), is also available for use as a blocking control in assays to test for specificity of this TMCO6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCO6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMCO6

Target: TMCO6 (Transmembrane and Coiled-Coil Domains 6 (TMCO6))

Alternative Name: TMCO6

Background: The function of TMCO6 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 54 kDa (MW of target protein)