ACLY antibody (Middle Region)

Catalog No. ABIN632477

The Rabbit Polyclonal anti-ACLY antibody is suitable to detect ACLY in samples from Human. It has been validated for WB.

Quick Overview for ACLY antibody (Middle Region) (ABIN632477)

Target: ACLY (ATP Citrate Lyase (ACLY))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACLY antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACLY Antibody

Binding Specificity: Middle Region

Specificity: ACLY antibody was raised against the middle region of ACLY

Purification: Affinity purified

Immunogen: ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACLY Blocking Peptide, (ABIN5611900), is also available for use as a blocking control in assays to test for specificity of this ACLY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACLY

Target: ACLY (ATP Citrate Lyase (ACLY))

Alternative Name: ACLY

Background: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Molecular Weight: 121 kDa (MW of target protein)

Pathways: Warburg Effect