ACLY antibody (Middle Region)

Catalog No. ABIN632477

Product Details anti-ACLY Antibody

Target: ACLY (ATP Citrate Lyase (ACLY))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACLY antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACLY antibody was raised against the middle region of ACLY

Purification: Affinity purified

Immunogen: ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACLY Blocking Peptide, catalog no. 33R-5389, is also available for use as a blocking control in assays to test for specificity of this ACLY antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACLY

Target: ACLY (ATP Citrate Lyase (ACLY))

Alternative Name: ACLY (ACLY Products)

Synonyms: ACLY antibody, DDBDRAFT_0205389 antibody, DDBDRAFT_0235360 antibody, DDB_0205389 antibody, DDB_0235360 antibody, ACL antibody, BcDNA:LD21334 antibody, CG8322 antibody, DmATPCL antibody, Dmel\\CG8322 antibody, anon-WO0140519.179 antibody, dATPCL antibody, l(2)01466 antibody, l(2)k09217 antibody, n(2)k09217 antibody, ATPCL antibody, CLATP antibody, A730098H14Rik antibody, AW538652 antibody, Clatp antibody, acly antibody, cb722 antibody, zgc:92008 antibody, ATP citrate lyase antibody, ATP citrate lyase S homeolog antibody, ATP-citrate synthase antibody, citrate synthase, mitochondrial antibody, atp-citrate synthase antibody, ATP citrate lyase a antibody, ACLY antibody, acly.S antibody, LOC587157 antibody, acly antibody, ATPCL antibody, LOC5564509 antibody, CpipJ_CPIJ010291 antibody, Bm1_26245 antibody, ACL antibody, Acly antibody, aclya antibody

Background: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Molecular Weight: 121 kDa (MW of target protein)

Pathways: Warburg Effect