ACP1 antibody (Middle Region)
-
- Target See all ACP1 Antibodies
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACP1 antibody was raised against the middle region of ACP1
- Purification
- Affinity purified
- Immunogen
- ACP1 antibody was raised using the middle region of ACP1 corresponding to a region with amino acids NISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFA
- Top Product
- Discover our top product ACP1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACP1 Blocking Peptide, catalog no. 33R-6731, is also available for use as a blocking control in assays to test for specificity of this ACP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACP1 (Acid Phosphatase 1, Soluble (ACP1))
- Alternative Name
- ACP1 (ACP1 Products)
- Synonyms
- HAAP antibody, 4632432E04Rik antibody, AI427468 antibody, Acp-1 antibody, LMW-PTP antibody, haap antibody, lmw-ptp antibody, ptp1a antibody, xlptp1 antibody, im:6910498 antibody, zgc:110844 antibody, Acp1 antibody, ACYPI006806 antibody, ACP antibody, ACPH antibody, APH antibody, Acph antibody, CG7899 antibody, Dmel\\CG7899 antibody, DDBDRAFT_0189318 antibody, DDBDRAFT_0266663 antibody, DDB_0189318 antibody, DDB_0266663 antibody, ACP1 antibody, XLPTP1 antibody, acp1 antibody, acp1a antibody, ptp1a-A antibody, LMW-PTPase antibody, acid phosphatase 1 antibody, acid phosphatase 1, soluble antibody, Acid phosphatase 1 antibody, acid phosphatase 1 L homeolog antibody, ACP1 antibody, Acp1 antibody, acp1 antibody, Acph-1 antibody, acp1.L antibody
- Background
- ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine phosphatase by hydrolyzing protein tyrosine phosphate to protein tyrosine and orthophosphate. This enzyme also hydrolyzes orthophosphoric monoesters to alcohol and orthophosphate.
- Molecular Weight
- 18 kDa (MW of target protein)
-