Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) antibody

Catalog No. ABIN632487

This anti-Chromosome 6 Open Reading Frame 134 antibody is a Rabbit Polyclonal antibody detecting Chromosome 6 Open Reading Frame 134 in WB. Suitable for Human.

Quick Overview for Chromosome 6 Open Reading Frame 134 (C6orf134) (N-Term) antibody (ABIN632487)

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: C6 orf134 antibody was raised against the N terminal of C6 rf134

Purification: Affinity purified

Immunogen: C6 orf134 antibody was raised using the N terminal of C6 rf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C6orf134 Blocking Peptide, (ABIN5612530), is also available for use as a blocking control in assays to test for specificity of this C6orf134 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf134 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: Chromosome 6 Open Reading Frame 134 (C6orf134)

Alternative Name: C6orf134

Background: The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 36 kDa (MW of target protein)