DMBT1 antibody (N-Term)

Catalog No. ABIN632489

The Rabbit Polyclonal anti-DMBT1 antibody has been validated for WB. It is suitable to detect DMBT1 in samples from Human.

Quick Overview for DMBT1 antibody (N-Term) (ABIN632489)

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DMBT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DMBT1 Antibody

Binding Specificity: N-Term

Specificity: DMBT1 antibody was raised against the N terminal of DMBT1

Purification: Affinity purified

Immunogen: DMBT1 antibody was raised using the N terminal of DMBT1 corresponding to a region with amino acids SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DMBT1 Blocking Peptide, (ABIN5613222), is also available for use as a blocking control in assays to test for specificity of this DMBT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DMBT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DMBT1

Target: DMBT1 (Deleted in Malignant Brain Tumors 1 (DMBT1))

Alternative Name: DMBT1

Background: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.

Molecular Weight: 258 kDa (MW of target protein)

Pathways: Activation of Innate immune Response