ADH1A antibody
-
- Target See all ADH1A Antibodies
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ADH1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids ESNYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENA
- Top Product
- Discover our top product ADH1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ADH1A Blocking Peptide, catalog no. 33R-2739, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))
- Alternative Name
- ADH1A (ADH1A Products)
- Background
- ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.
- Molecular Weight
- 40 kDa (MW of target protein)
-