ADH1A antibody

Catalog No. ABIN632492

Product Details anti-ADH1A Antibody

Target: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADH1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ADH1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids NYCLKNDVSNPQGTLQDGTSRFTCRRKPIHHFLGISTFSQYTVVDENAVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADH1A Blocking Peptide, catalog no. 33R-6935, is also available for use as a blocking control in assays to test for specificity of this ADH1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADH1A

Target: ADH1A (Alcohol Dehydrogenase 1A (Class I), alpha Polypeptide (ADH1A))

Alternative Name: ADH1A (ADH1A Products)

Background: ADH1A is class I alcohol dehydrogenase, alpha subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Molecular Weight: 40 kDa (MW of target protein)