ADH1B antibody

Catalog No. ABIN632493

This anti-ADH1B antibody is a Rabbit Polyclonal antibody detecting ADH1B in WB. Suitable for Human.

Quick Overview for ADH1B antibody (ABIN632493)

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADH1B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADH1B Antibody

Purification: Affinity purified

Immunogen: ADH1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADH1B Blocking Peptide, (ABIN5611949), is also available for use as a blocking control in assays to test for specificity of this ADH1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADH0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADH1B

Target: ADH1B (Alcohol Dehydrogenase 1B (Class I), beta Polypeptide (ADH1B))

Alternative Name: ADH1B

Background: ADH1B is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. This protein, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism.

Molecular Weight: 40 kDa (MW of target protein)