MAGEA10 antibody (Middle Region)
-
- Target See all MAGEA10 Antibodies
- MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEA10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEA10 antibody was raised against the middle region of MAGEA10
- Purification
- Affinity purified
- Immunogen
- MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP
- Top Product
- Discover our top product MAGEA10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEA10 Blocking Peptide, catalog no. 33R-6797, is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))
- Alternative Name
- MAGEA10 (MAGEA10 Products)
- Background
- This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.
- Molecular Weight
- 41 kDa (MW of target protein)
-