MAGEA10 antibody (Middle Region)

Catalog No. ABIN632495

The Rabbit Polyclonal anti-MAGEA10 antibody has been validated for WB. It is suitable to detect MAGEA10 in samples from Human.

Quick Overview for MAGEA10 antibody (Middle Region) (ABIN632495)

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEA10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEA10 Antibody

Binding Specificity: Middle Region

Specificity: MAGEA10 antibody was raised against the middle region of MAGEA10

Purification: Affinity purified

Immunogen: MAGEA10 antibody was raised using the middle region of MAGEA10 corresponding to a region with amino acids GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEA10 Blocking Peptide, (ABIN938941), is also available for use as a blocking control in assays to test for specificity of this MAGEA10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEA10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEA10

Target: MAGEA10 (Melanoma Antigen Family A, 10 (MAGEA10))

Alternative Name: MAGEA10

Background: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other.

Molecular Weight: 41 kDa (MW of target protein)