COBLL1 antibody (Middle Region)

Catalog No. ABIN632504

The Rabbit Polyclonal anti-COBLL1 antibody has been validated for WB. It is suitable to detect COBLL1 in samples from Human.

Quick Overview for COBLL1 antibody (Middle Region) (ABIN632504)

Target: COBLL1 (COBL-Like 1 (COBLL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COBLL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COBLL1 Antibody

Binding Specificity: Middle Region

Specificity: Cobl-Like 1 antibody was raised against the middle region of COBLL1

Purification: Affinity purified

Immunogen: Cobl-Like 1 antibody was raised using the middle region of COBLL1 corresponding to a region with amino acids QAKPSSFFLQMQKRVSGHYVTSAAAKSVHAAPNPAPKELTNKEAERDMLP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cobl-Like 1 Blocking Peptide, (ABIN5612945), is also available for use as a blocking control in assays to test for specificity of this Cobl-Like 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COBLL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COBLL1

Target: COBLL1 (COBL-Like 1 (COBLL1))

Alternative Name: Cobl-Like 1

Background: The function of COBLL1 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 128 kDa (MW of target protein)