CES2 antibody

Catalog No. ABIN632514

The Rabbit Polyclonal anti-CES2 antibody (ABIN632514) specifically detects CES2 in WB. The antibody is reactive with Human samples.

Quick Overview for CES2 antibody (ABIN632514)

Target: CES2 (Carboxylesterase 2 (CES2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CES2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CES2 Antibody

Purification: Affinity purified

Immunogen: Carboxylesterase 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QHQPSWLKNIRPPHMKADHVKFTEEEEQLSRKMMKYWANFARNGNPNGEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxylesterase 2 Blocking Peptide, (ABIN5612611), is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CES2

Target: CES2 (Carboxylesterase 2 (CES2))

Alternative Name: Carboxylesterase 2

Background: Carboxylesterase 2 is a member of a large multigene family. The enzymes are responsible for the hydrolysis of ester- and amide-bond-containing drugs such as cocaine and heroin. They also hydrolize long-chain fatty acid esters and thioesters.

Molecular Weight: 67 kDa (MW of target protein)