HSPA4L antibody (C-Term)
-
- Target See all HSPA4L Antibodies
- HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HSPA4L antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HSPA4 L antibody was raised against the C terminal of HSPA4
- Purification
- Affinity purified
- Immunogen
- HSPA4 L antibody was raised using the C terminal of HSPA4 corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI
- Top Product
- Discover our top product HSPA4L Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HSPA4L Blocking Peptide, catalog no. 33R-4284, is also available for use as a blocking control in assays to test for specificity of this HSPA4L antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))
- Alternative Name
- HSPA4L (HSPA4L Products)
- Synonyms
- APG-1 antibody, HSPH3 antibody, Osp94 antibody, 94kDa antibody, AI461691 antibody, OSP94 antibody, heat shock protein family A (Hsp70) member 4 like antibody, heat shock protein 4 like antibody, HSPA4L antibody, Hspa4l antibody
- Background
- HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.
- Molecular Weight
- 92 kDa (MW of target protein)
-