HSPA4L antibody (C-Term)

Catalog No. ABIN632518

This Rabbit Polyclonal antibody specifically detects HSPA4L in WB. It exhibits reactivity toward Human.

Quick Overview for HSPA4L antibody (C-Term) (ABIN632518)

Target: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HSPA4L antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HSPA4L Antibody

Binding Specificity: C-Term

Specificity: HSPA4 L antibody was raised against the C terminal of HSPA4

Purification: Affinity purified

Immunogen: HSPA4 L antibody was raised using the C terminal of HSPA4 corresponding to a region with amino acids KDERYDHLDPTEMEKVEKCISDAMSWLNSKMNAQNKLSLTQDPVVKVSEI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HSPA4L Blocking Peptide, (ABIN939670), is also available for use as a blocking control in assays to test for specificity of this HSPA4L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HSPA4L

Target: HSPA4L (Heat Shock 70kDa Protein 4-Like (HSPA4L))

Alternative Name: HSPA4L

Background: HSPA4L belongs to the heat shock protein 70 family. HSPA4L possesses chaperone activity in vitro where it inhibits aggregation of citrate synthase.

Molecular Weight: 92 kDa (MW of target protein)