C2orf42 antibody (C-Term)

Catalog No. ABIN632522

The Rabbit Polyclonal anti-C2orf42 antibody has been validated for WB. It is suitable to detect C2orf42 in samples from Human and Rat.

Quick Overview for C2orf42 antibody (C-Term) (ABIN632522)

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C2orf42 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C2orf42 Antibody

Binding Specificity: C-Term

Specificity: C2 ORF42 antibody was raised against the C terminal Of C2 rf42

Purification: Affinity purified

Immunogen: C2 ORF42 antibody was raised using the C terminal Of C2 rf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C2ORF42 Blocking Peptide, (ABIN939574), is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF42 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C2orf42

Target: C2orf42 (Chromosome 2 Open Reading Frame 42 (C2orf42))

Alternative Name: C2ORF42

Background: The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 63 kDa (MW of target protein)