TCP11 antibody

Catalog No. ABIN632523

Product Details anti-TCP11 Antibody

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TCP11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: TCP11 antibody was raised using a synthetic peptide corresponding to a region with amino acids CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TCP11 Blocking Peptide, catalog no. 33R-1827, is also available for use as a blocking control in assays to test for specificity of this TCP11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCP11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TCP11

Target: TCP11 (T-Complex 11, Testis-Specific (TCP11))

Alternative Name: TCP11 (TCP11 Products)

Synonyms: D6S230E antibody, FPPR antibody, D17Ken1 antibody, Tcp-11 antibody, t-complex 11 antibody, t-complex protein 11 antibody, Tcp11 antibody, TCP11 antibody

Background: TCP11 may play an important role in sperm function and fertility.

Molecular Weight: 49 kDa (MW of target protein)