GALM antibody

Catalog No. ABIN632539

Product Details anti-GALM Antibody

Target: GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GALM antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GALM antibody was raised using a synthetic peptide corresponding to a region with amino acids SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GALM Blocking Peptide, catalog no. 33R-8549, is also available for use as a blocking control in assays to test for specificity of this GALM antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GALM

Target: GALM (Galactose Mutarotase (Aldose 1-Epimerase) (GALM))

Alternative Name: GALM (GALM Products)

Synonyms: GALM antibody, A530057M15Rik antibody, AU015645 antibody, AU020959 antibody, MUT antibody, IBD1 antibody, galactose mutarotase antibody, galactose mutarotase (aldose 1-epimerase) antibody, Aldose-1-epimerase (Galactose mutarotase) antibody, galactose mutarotase (aldose 1-epimerase) L homeolog antibody, GALM antibody, galm antibody, galM antibody, galm.L antibody, Ping_2018 antibody, BRADO1815 antibody, BBta_2135 antibody, Spro_1290 antibody, PC1_1264 antibody, Dd586_1213 antibody, Kvar_3617 antibody, AOLE_14520 antibody, Entcl_3074 antibody, Pat9b_1148 antibody, Rahaq_3123 antibody, Ccan_05570 antibody, Galm antibody

Background: GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.

Molecular Weight: 38 kDa (MW of target protein)