GAS8 antibody (N-Term)

Catalog No. ABIN632541

The Rabbit Polyclonal anti-GAS8 antibody (ABIN632541) specifically detects GAS8 in WB. The antibody is reactive with Human samples.

Quick Overview for GAS8 antibody (N-Term) (ABIN632541)

Target: GAS8 (Growth Arrest-Specific 8 (GAS8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAS8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GAS8 Antibody

Binding Specificity: N-Term

Specificity: GAS8 antibody was raised against the N terminal of GAS8

Purification: Affinity purified

Immunogen: GAS8 antibody was raised using the N terminal of GAS8 corresponding to a region with amino acids VSRIREELDREREERNYFQLERDKIHTFWEITRRQLEEKKAELRNKDREM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAS8 Blocking Peptide, (ABIN5613729), is also available for use as a blocking control in assays to test for specificity of this GAS8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAS8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAS8

Target: GAS8 (Growth Arrest-Specific 8 (GAS8))

Alternative Name: GAS8

Background: This gene includes 11 exons spanning 25 kb and maps to a region of chromosome 16 that is sometimes deleted in breast and prostrate cancer. The second intron contains an apparently intronless gene, C16orf3, that is transcribed in the opposite orientation. This gene is a putative tumor suppressor gene.

Molecular Weight: 56 kDa (MW of target protein)