ARL13B antibody (Middle Region)

Catalog No. ABIN632542

This Rabbit Polyclonal antibody specifically detects ARL13B in WB. It exhibits reactivity toward Human.

Quick Overview for ARL13B antibody (Middle Region) (ABIN632542)

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARL13B antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARL13B Antibody

Binding Specificity: Middle Region

Specificity: ARL13 B antibody was raised against the middle region of ARL13

Purification: Affinity purified

Immunogen: ARL13 B antibody was raised using the middle region of ARL13 corresponding to a region with amino acids RVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARL13B Blocking Peptide, (ABIN5612158), is also available for use as a blocking control in assays to test for specificity of this ARL13B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARL13B

Target: ARL13B (ADP-Ribosylation Factor-Like 13B (ARL13B))

Alternative Name: ARL13B

Background: ARL13B has an evolutionarily conserved role mediating cilia function in multiple organs. N and C domains of ARL13B cooperatively regulate its ciliary localization and that N domain-dependent self-association of Arl13b may be important for its function in cilia biogenesis.

Molecular Weight: 37 kDa (MW of target protein)