CHCHD1 antibody (N-Term)

Catalog No. ABIN632544

The Rabbit Polyclonal anti-CHCHD1 antibody (ABIN632544) specifically detects CHCHD1 in WB. The antibody is reactive with Human samples.

Quick Overview for CHCHD1 antibody (N-Term) (ABIN632544)

Target: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHCHD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHCHD1 Antibody

Binding Specificity: N-Term

Specificity: CHCHD1 antibody was raised against the N terminal of CHCHD1

Purification: Affinity purified

Immunogen: CHCHD1 antibody was raised using the N terminal of CHCHD1 corresponding to a region with amino acids MATPSLRGRLARFGNPRKPVLKPNKPLILANRVGERRREKGEATCITEMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHCHD1 Blocking Peptide, (ABIN5612837), is also available for use as a blocking control in assays to test for specificity of this CHCHD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHCHD1

Target: CHCHD1 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 1 (CHCHD1))

Alternative Name: CHCHD1

Background: The function of CHCHD protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 13 kDa (MW of target protein)