UBE2O antibody (Middle Region)

Catalog No. ABIN632557

This Rabbit Polyclonal antibody specifically detects UBE2O in WB. It exhibits reactivity toward Human.

Quick Overview for UBE2O antibody (Middle Region) (ABIN632557)

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2O antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UBE2O Antibody

Binding Specificity: Middle Region

Specificity: UBE2 O antibody was raised against the middle region of UBE2

Purification: Affinity purified

Immunogen: UBE2 O antibody was raised using the middle region of UBE2 corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2O Blocking Peptide, (ABIN936163), is also available for use as a blocking control in assays to test for specificity of this UBE2O antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2O

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Alternative Name: UBE2O

Background: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Molecular Weight: 141 kDa (MW of target protein)