UBE2O antibody (Middle Region)

Catalog No. ABIN632557

Product Details anti-UBE2O Antibody

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UBE2O antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UBE2 O antibody was raised against the middle region of UBE2

Purification: Affinity purified

Immunogen: UBE2 O antibody was raised using the middle region of UBE2 corresponding to a region with amino acids YNEAGFDSDRGLQEGYENSRCYNEMALIRVVQSMTQLVRRPPEVFEQEIR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UBE2O Blocking Peptide, catalog no. 33R-10192, is also available for use as a blocking control in assays to test for specificity of this UBE2O antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UBE2O

Target: UBE2O (Ubiquitin-Conjugating Enzyme E2O (UBE2O))

Alternative Name: UBE2O (UBE2O Products)

Synonyms: e2-230k antibody, E2-230K antibody, 9630022H21 antibody, B230113M03Rik antibody, mKIAA1734 antibody, RGD1310297 antibody, ubiquitin conjugating enzyme E2 O antibody, ubiquitin-conjugating enzyme E2O antibody, UBE2O antibody, ube2o antibody, Ube2o antibody

Background: UBE2O catalyzes the covalent attachment of ubiquitin to other proteins.

Molecular Weight: 141 kDa (MW of target protein)