PNRC2 antibody (Middle Region)

Catalog No. ABIN632558

The Rabbit Polyclonal anti-PNRC2 antibody is suitable to detect PNRC2 in samples from Human. It has been validated for WB.

Quick Overview for PNRC2 antibody (Middle Region) (ABIN632558)

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNRC2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PNRC2 Antibody

Binding Specificity: Middle Region

Specificity: PNRC2 antibody was raised against the middle region of PNRC2

Purification: Affinity purified

Immunogen: PNRC2 antibody was raised using the middle region of PNRC2 corresponding to a region with amino acids NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNRC2 Blocking Peptide, (ABIN5615444), is also available for use as a blocking control in assays to test for specificity of this PNRC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNRC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNRC2

Target: PNRC2 (Proline Rich Nuclear Receptor Coactivator 2 (PNRC2))

Alternative Name: PNRC2

Background: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Molecular Weight: 15 kDa (MW of target protein)