CRTAC1 antibody (N-Term)

Catalog No. ABIN632560

Product Details anti-CRTAC1 Antibody

Target: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRTAC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRTAC1 antibody was raised against the N terminal of CRTAC1

Purification: Affinity purified

Immunogen: CRTAC1 antibody was raised using the N terminal of CRTAC1 corresponding to a region with amino acids FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRTAC1 Blocking Peptide, catalog no. 33R-3085, is also available for use as a blocking control in assays to test for specificity of this CRTAC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRTAC1

Target: CRTAC1 (Cartilage Acidic Protein 1 (CRTAC1))

Alternative Name: CRTAC1 (CRTAC1 Products)

Synonyms: ASPIP antibody, cb184 antibody, crtac1 antibody, sb:cb184 antibody, zgc:165343 antibody, aspic1 antibody, cep-68 antibody, MGC146658 antibody, ASPIC antibody, ASPIC1 antibody, CEP-68 antibody, 2810454P21Rik antibody, AW047536 antibody, Crtac1B antibody, Lotus antibody, W307 antibody, cartilage acidic protein 1 antibody, cartilage acidic protein 1a antibody, CRTAC1 antibody, crtac1a antibody, crtac1 antibody, aspip antibody, Crtac1 antibody

Background: The function of CRTAC protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 71 kDa (MW of target protein)