WDR49 antibody (N-Term)

Catalog No. ABIN632570

The Rabbit Polyclonal anti-WDR49 antibody has been validated for WB. It is suitable to detect WDR49 in samples from Human.

Quick Overview for WDR49 antibody (N-Term) (ABIN632570)

Target: WDR49 (WD Repeat Domain 49 (WDR49))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WDR49 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-WDR49 Antibody

Binding Specificity: N-Term

Specificity: WDR49 antibody was raised against the N terminal of WDR49

Purification: Affinity purified

Immunogen: WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WDR49 Blocking Peptide, (ABIN5616999), is also available for use as a blocking control in assays to test for specificity of this WDR49 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WDR49

Target: WDR49 (WD Repeat Domain 49 (WDR49))

Alternative Name: WDR49

Background: WDR49 contains 8 WD repeats. The exact function of WDR49 remains unknown.

Molecular Weight: 79 kDa (MW of target protein)