C18ORF25 antibody (N-Term)

Catalog No. ABIN632578

This Rabbit Polyclonal antibody specifically detects C18ORF25 in WB. It exhibits reactivity toward Human.

Quick Overview for C18ORF25 antibody (N-Term) (ABIN632578)

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C18ORF25 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C18ORF25 Antibody

Binding Specificity: N-Term

Specificity: C18 orf25 antibody was raised against the N terminal of C18 rf25

Purification: Affinity purified

Immunogen: C18 orf25 antibody was raised using the N terminal of C18 rf25 corresponding to a region with amino acids MKMEEAVGKVEELIESEAPPKASEQETAKEEDGSVELESQVQKDGVADST

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C18orf25 Blocking Peptide, (ABIN5612434), is also available for use as a blocking control in assays to test for specificity of this C18orf25 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 rf25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C18ORF25

Target: C18ORF25 (Chromosome 18 Open Reading Frame 25 (C18ORF25))

Alternative Name: C18orf25

Background: The function of C18orf25 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 37 kDa (MW of target protein)