C1orf144 antibody (N-Term)

Catalog No. ABIN632581

This Rabbit Polyclonal antibody specifically detects C1orf144 in WB. It exhibits reactivity toward Human.

Quick Overview for C1orf144 antibody (N-Term) (ABIN632581)

Target: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1orf144 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C1orf144 Antibody

Binding Specificity: N-Term

Specificity: C1 orf144 antibody was raised against the N terminal of C1 rf144

Purification: Affinity purified

Immunogen: C1 orf144 antibody was raised using the N terminal of C1 rf144 corresponding to a region with amino acids MRRSLRAGKRRQTAGRKSKSPPKVPIVIQDDSLPAGPPPQIRILKRPTSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1orf144 Blocking Peptide, (ABIN5612455), is also available for use as a blocking control in assays to test for specificity of this C1orf144 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf144 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1orf144

Target: C1orf144 (Chromosome 1 Open Reading Frame 144 (C1orf144))

Alternative Name: C1orf144

Background: The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 15 kDa (MW of target protein)