ACBD3 antibody (N-Term)

Catalog No. ABIN632589

Product Details anti-ACBD3 Antibody

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACBD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACBD3 antibody was raised against the N terminal of ACBD3

Purification: Affinity purified

Immunogen: ACBD3 antibody was raised using the N terminal of ACBD3 corresponding to a region with amino acids EARRLEQRWGFGLEELYGLALRFFKEKDGKAFHPTYEEKLKLVALHKQVL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACBD3 Blocking Peptide, catalog no. 33R-2282, is also available for use as a blocking control in assays to test for specificity of this ACBD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACBD3

Target: ACBD3 (Acbd3) (Acyl-CoA Binding Domain Containing 3 (Acbd3))

Alternative Name: ACBD3 (Acbd3 Products)

Background: The protein encoded by this gene is involved in the maintenance of Golgi structure and function through its interaction with the integral membrane protein giantin. It may also be involved in the hormonal regulation of steroid formation.

Molecular Weight: 60 kDa (MW of target protein)