RIBC1 antibody (Middle Region)

Catalog No. ABIN632596

This Rabbit Polyclonal antibody specifically detects RIBC1 in WB. It exhibits reactivity toward Human.

Quick Overview for RIBC1 antibody (Middle Region) (ABIN632596)

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RIBC1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RIBC1 Antibody

Binding Specificity: Middle Region

Specificity: RIBC1 antibody was raised against the middle region of RIBC1

Purification: Affinity purified

Immunogen: RIBC1 antibody was raised using the middle region of RIBC1 corresponding to a region with amino acids ANANKAQAAVQAGRQRCERQREQKANLAEIQHQSTSDLLTENPQVAQHPM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RIBC1 Blocking Peptide, (ABIN936779), is also available for use as a blocking control in assays to test for specificity of this RIBC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RIBC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RIBC1

Target: RIBC1 (RIB43A Domain with Coiled-Coils 1 (RIBC1))

Alternative Name: RIBC1

Background: The function of RIBC1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 44 kDa (MW of target protein)