MAGEB4 antibody (N-Term)

Catalog No. ABIN632604

This anti-MAGEB4 antibody is a Rabbit Polyclonal antibody detecting MAGEB4 in WB. Suitable for Human.

Quick Overview for MAGEB4 antibody (N-Term) (ABIN632604)

Target: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAGEB4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAGEB4 Antibody

Binding Specificity: N-Term

Specificity: MAGEB4 antibody was raised against the N terminal of MAGEB4

Purification: Affinity purified

Immunogen: MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAGEB4 Blocking Peptide, (ABIN939715), is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAGEB4

Target: MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))

Alternative Name: MAGEB4

Background: This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.

Molecular Weight: 39 kDa (MW of target protein)