MAGEB4 antibody (N-Term)
-
- Target See all MAGEB4 Antibodies
- MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))
-
Binding Specificity
- N-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MAGEB4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MAGEB4 antibody was raised against the N terminal of MAGEB4
- Purification
- Affinity purified
- Immunogen
- MAGEB4 antibody was raised using the N terminal of MAGEB4 corresponding to a region with amino acids KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD
- Top Product
- Discover our top product MAGEB4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MAGEB4 Blocking Peptide, catalog no. 33R-4329, is also available for use as a blocking control in assays to test for specificity of this MAGEB4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAGEB4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAGEB4 (Melanoma Antigen Family B, 4 (MAGEB4))
- Alternative Name
- MAGEB4 (MAGEB4 Products)
- Background
- This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEB genes are clustered on chromosome Xp22-p21. This gene sequence ends in the first intron of MAGEB1, another family member. This gene is expressed in testis.
- Molecular Weight
- 39 kDa (MW of target protein)
-