RP11-298P3.3 (N-Term) antibody

Catalog No. ABIN632609

The Rabbit Polyclonal anti- antibody has been validated for WB. It is suitable to detect in samples from Human.

Quick Overview for RP11-298P3.3 (N-Term) antibody (ABIN632609)

Target: RP11-298P3.3

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: N-Term

Specificity: RP11-298 P3.3 antibody was raised against the N terminal of RP11-298 3.3

Purification: Affinity purified

Immunogen: RP11-298 P3.3 antibody was raised using the N terminal of RP11-298 3.3 corresponding to a region with amino acids EYQMSISIVMNSVEPSHKSTQRPPPPQGRQRERVLKKTGHRLSKTKQKRN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RP.3 Blocking Peptide, (ABIN938214), is also available for use as a blocking control in assays to test for specificity of this RP.3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-290 3.3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: RP11-298P3.3

Background: The function of RP11-298P3.3 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 87 kDa (MW of target protein)