SPATA24 antibody (C-Term)

Catalog No. ABIN632623

This Rabbit Polyclonal antibody specifically detects SPATA24 in WB. It exhibits reactivity toward Human.

Quick Overview for SPATA24 antibody (C-Term) (ABIN632623)

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA24 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SPATA24 Antibody

Binding Specificity: C-Term

Specificity: SPATA24 antibody was raised against the c terminal of SPATA24

Purification: Affinity purified

Immunogen: SPATA24 antibody was raised using the C terminal of SPATA24 corresponding to a region with amino acids LQQVISQQKQIFRNHMSDFRIQKQQESYMAQVLDQKHKKASGTRQARSHQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA24 Blocking Peptide, (ABIN5616361), is also available for use as a blocking control in assays to test for specificity of this SPATA24 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA24 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA24

Target: SPATA24 (Spermatogenesis Associated 24 (SPATA24))

Alternative Name: SPATA24

Background: SPATA24 binds DNA with high affinity but does not bind to TATA boxes.SPATA24 synergises with GMNN and TBP in activation of TATA box-containing promoters and with GMNN and TBPL1 in activation of the NF1 TATA-less promoter.

Molecular Weight: 23 kDa (MW of target protein)