MAT2A antibody (Middle Region)

Catalog No. ABIN632627

The Rabbit Polyclonal anti-MAT2A antibody is suitable to detect MAT2A in samples from Human. It has been validated for WB.

Quick Overview for MAT2A antibody (Middle Region) (ABIN632627)

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT2A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAT2A Antibody

Binding Specificity: Middle Region

Specificity: MAT2 A antibody was raised against the middle region of MAT2

Purification: Affinity purified

Immunogen: MAT2 A antibody was raised using the middle region of MAT2 corresponding to a region with amino acids LLEIVKKNFDLRPGVIVRDLDLKKPIYQRTAAYGHFGRDSFPWEVPKKLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT2A Blocking Peptide, (ABIN940514), is also available for use as a blocking control in assays to test for specificity of this MAT2A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT2A

Target: MAT2A (Methionine Adenosyltransferase II, alpha (MAT2A))

Alternative Name: MAT2A

Background: MAT2A catalyzes the formation of S-adenosylmethionine from methionine and ATP.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process