REM1 antibody

Catalog No. ABIN632639

Product Details anti-REM1 Antibody

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This REM1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REM1 Blocking Peptide, catalog no. 33R-8372, is also available for use as a blocking control in assays to test for specificity of this REM1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REM1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for REM1

Target: REM1 (RAS (RAD and GEM)-Like GTP-Binding 1 (REM1))

Alternative Name: REM1 (REM1 Products)

Synonyms: GD:REM antibody, GES antibody, E030011C07Rik antibody, Rem antibody, GEM antibody, SI:zK76P14.3 antibody, horizin antibody, rem antibody, zgc:56144 antibody, RRAD and GEM like GTPase 1 antibody, rad and gem related GTP binding protein 1 antibody, RAS (RAD and GEM)-like GTP-binding 1 antibody, REM1 antibody, Rem1 antibody, rem1 antibody

Background: The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Molecular Weight: 33 kDa (MW of target protein)