GAN antibody (Middle Region)

Catalog No. ABIN632648

Product Details anti-GAN Antibody

Target: GAN (Gigaxonin (GAN))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GAN antibody was raised against the middle region of GAN

Purification: Affinity purified

Immunogen: GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAN Blocking Peptide, catalog no. 33R-4223, is also available for use as a blocking control in assays to test for specificity of this GAN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAN

Target: GAN (Gigaxonin (GAN))

Alternative Name: GAN (GAN Products)

Synonyms: MGC81691 antibody, GAN antibody, A330045G18 antibody, gigaxonin antibody, GAN1 antibody, KLHL16 antibody, gigaxonin L homeolog antibody, gigaxonin antibody, giant axonal neuropathy antibody, gan.L antibody, gan antibody, GAN antibody, Gan antibody

Background: This gene encodes a member of the cytoskeletal BTB/kelch (Broad-Complex, Tramtrack and Bric a brac) repeat family. The encoded protein plays a role in neurofilament architecture and is involved in mediating the ubiquitination and degradation of some proteins. Defects in this gene are a cause of giant axonal neuropathy (GAN).

Molecular Weight: 66 kDa (MW of target protein)