FAM160B1 antibody (N-Term)

Catalog No. ABIN632652

This anti-FAM160B1 antibody is a Rabbit Polyclonal antibody detecting FAM160B1 in WB. Suitable for Human.

Quick Overview for FAM160B1 antibody (N-Term) (ABIN632652)

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FAM160B1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FAM160B1 Antibody

Binding Specificity: N-Term

Specificity: FAM160 B1 antibody was raised against the N terminal of FAM160 1

Purification: Affinity purified

Immunogen: FAM160 B1 antibody was raised using the N terminal of FAM160 1 corresponding to a region with amino acids HYYIETSDDKAPVTDTNIPSHLEQMLDILVQEENERESGETGPCMEYLLH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FAM160B1 Blocking Peptide, (ABIN939270), is also available for use as a blocking control in assays to test for specificity of this FAM160B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM160 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FAM160B1

Target: FAM160B1 (Family with Sequence Similarity 160, Member B1 (FAM160B1))

Alternative Name: FAM160B1

Background: The function of FAM160 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 86 kDa (MW of target protein)