HOMER1 antibody

Catalog No. ABIN632669

The Rabbit Polyclonal anti-HOMER1 antibody has been validated for WB. It is suitable to detect HOMER1 in samples from Human, Mouse, Rat and Dog.

Quick Overview for HOMER1 antibody (ABIN632669)

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HOMER1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-HOMER1 Antibody

Purification: Affinity purified

Immunogen: HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPLTPESINGTDD

Application Details

Application Notes: WB: 0.0156 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HOMER1 Blocking Peptide, (ABIN937888), is also available for use as a blocking control in assays to test for specificity of this HOMER1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HOMER1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HOMER1

Target: HOMER1 (Homer Homolog 1 (HOMER1))

Alternative Name: HOMER1

Background: HOMER1 is a member of the homer family of dendritic proteins. Members of this family regulate group 1 metabotrophic glutamate receptor function.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Skeletal Muscle Fiber Development