Family with Sequence Similarity 113, Member A (FAM113A) (N-Term) antibody

Details for Product No. ABIN632679
Human, Mouse (Murine)
Western Blotting (WB)
Immunogen FAM113 A antibody was raised using the N terminal of FAM113 corresponding to a region with amino acids VLLLQKDSLLTAAQLKAKGELSFEQDQLVAGGQLGELHNGTQYREVRQFC
Specificity FAM113 A antibody was raised against the N terminal of FAM113
Purification Affinity purified
Alternative Name FAM113A (FAM113A Antibody Abstract)
Background FAM113A is involved in protein binding and hydrolase activity.
Molecular Weight 52 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

FAM113A Blocking Peptide, catalog no. 33R-9674, is also available for use as a blocking control in assays to test for specificity of this FAM113A antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM110 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Family with Sequence Similarity 113, Member A (FAM113A) (N-Term) antibody (ABIN632679) FAM113A antibody used at 1 ug/ml to detect target protein.