ADSSL1 antibody (Middle Region)

Catalog No. ABIN632681

The Rabbit Polyclonal anti-ADSSL1 antibody has been validated for WB. It is suitable to detect ADSSL1 in samples from Human, Mouse and Rat.

Quick Overview for ADSSL1 antibody (Middle Region) (ABIN632681)

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADSSL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADSSL1 Antibody

Binding Specificity: Middle Region

Specificity: ADSSL1 antibody was raised against the middle region of ADSSL1

Purification: Affinity purified

Immunogen: ADSSL1 antibody was raised using the middle region of ADSSL1 corresponding to a region with amino acids VDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADSSL1 Blocking Peptide, (ABIN5611965), is also available for use as a blocking control in assays to test for specificity of this ADSSL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADSSL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADSSL1

Target: ADSSL1 (Adenylosuccinate Synthase Like 1 (ADSSL1))

Alternative Name: ADSSL1

Background: ADSSL1 is a muscle isozyme of adenylosuccinate synthase (EC 6.3.4.4), which catalyzes the initial reaction in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP).

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process