PPP1R27 antibody (Middle Region)

Catalog No. ABIN632687

The Rabbit Polyclonal anti-PPP1R27 antibody has been validated for WB. It is suitable to detect PPP1R27 in samples from Human, Rat and Mouse.

Quick Overview for PPP1R27 antibody (Middle Region) (ABIN632687)

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPP1R27 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PPP1R27 Antibody

Binding Specificity: Middle Region

Specificity: DYSFIP1 antibody was raised against the middle region of DYSFIP1

Purification: Affinity purified

Immunogen: DYSFIP1 antibody was raised using the middle region of DYSFIP1 corresponding to a region with amino acids DHIRQGDLEQVGRFIRTRKVSLATIHPSGLAALHEAVLSGNLECVKLLVK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYSFIP1 Blocking Peptide, (ABIN937362), is also available for use as a blocking control in assays to test for specificity of this DYSFIP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYSFIP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPP1R27

Target: PPP1R27 (Protein Phosphatase 1, Regulatory Subunit 27 (PPP1R27))

Alternative Name: DYSFIP1

Background: The function of DYSFIP1 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 17 kDa (MW of target protein)