LRRC17 antibody (Middle Region)

Catalog No. ABIN632693

The Rabbit Polyclonal anti-LRRC17 antibody is suitable to detect LRRC17 in samples from Human. It has been validated for WB.

Quick Overview for LRRC17 antibody (Middle Region) (ABIN632693)

Target: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LRRC17 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LRRC17 Antibody

Binding Specificity: Middle Region

Specificity: LRRC17 antibody was raised against the middle region of LRRC17

Purification: Affinity purified

Immunogen: LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LRRC17 Blocking Peptide, (ABIN936254), is also available for use as a blocking control in assays to test for specificity of this LRRC17 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC17 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LRRC17

Target: LRRC17 (Leucine Rich Repeat Containing 17 (LRRC17))

Alternative Name: LRRC17

Background: LRRC17 contains 6 LRR (leucine-rich) repeats. The exact function of LRRC17 remains unknown.

Molecular Weight: 52 kDa (MW of target protein)